PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 198aa    MW: 23013 Da    PI: 9.0774
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610370.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.6e-191865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l d+vk +G+g+W++Ia++ g++R++k+c++rw +yl
   XP_013610370.1 18 KGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL 65
                     678*******************************************97 PP

2Myb_DNA-binding60.53.6e-1971116148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
   XP_013610370.1  71 RGNFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 116
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.951365IPR017930Myb domain
SuperFamilySSF466892.89E-3116112IPR009057Homeodomain-like
SMARTSM007172.6E-151767IPR001005SANT/Myb domain
PfamPF002494.8E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-251972IPR009057Homeodomain-like
CDDcd001678.75E-122165No hitNo description
PROSITE profilePS5129428.34366120IPR017930Myb domain
SMARTSM007171.4E-1870118IPR001005SANT/Myb domain
PfamPF002495.8E-1871116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2773120IPR009057Homeodomain-like
CDDcd001674.33E-1373116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045165Biological Processcell fate commitment
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MRKNVSSSGE EGNNEYKKGL WTVEEDKILM DYVKAHGKGH WNRIAKKTGL KRCGKSCRLR  60
WMNYLSPNVK RGNFTDQEED LIIRLHKLLG NRWSLIAKRV PGRTDNQVKN YWNTHLSKKL  120
GIKDPKNKPS NGDIVYQINL TNPTETMEET KISNINDNDE IQEDRHGSNY LSSLWVHDDA  180
FELSTLTNMM DFLDGHCF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29181207108B-MYB
1h8a_C5e-291312022128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3171410.0HQ317141.1 Brassica rapa subsp. rapa cultivar Tsuda MYB domain protein 66 (MYB66) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610370.11e-147PREDICTED: transcription factor WER
SwissprotQ9SEI01e-134WER_ARATH; Transcription factor WER
TrEMBLA0A0D3EFG81e-147A0A0D3EFG8_BRAOL; Uncharacterized protein
STRINGBra008740.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-135myb domain protein 66